Loading...
Statistics
Advertisement

Scale Service & Supply | Business & Industrial Scale Solutions
www.scaleschool.com/
We service, rent, calibrate and supply scales at competitive price. Business and Industry Scale Solutions and Service for over 30 years.

Scaleschool.com

Advertisement
Conversion Technology Metas Server
Scaleschool.com is hosted in United States / Pittsburgh . Scaleschool.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 3. First javascripts: Jquery.js, Jquery-migrate.min.js, Functions.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.4.18. Its CMS is: Wordpress.

Technologies in use by Scaleschool.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 3
  • jquery.js
  • jquery-migrate.min.js
  • functions.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.18

Google Analytics ID

  • UA-23173699-3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Scaleschool.com

Missing HTTPS protocol.

    Meta - Scaleschool.com

    Number of occurences: 4
    • Name:
      Content: Scale Service & Supply
    • Name: viewport
      Content: width=device-width
    • Name: description
      Content: We service, rent, calibrate and supply scales at competitive price. Business and Industry Scale Solutions and Service for over 30 years.
    • Name: generator
      Content: WordPress 4.1.10

    Server / Hosting

    • IP: 66.39.70.20
    • Latitude: 40.42
    • Longitude: -79.98
    • Country: United States
    • City: Pittsburgh

    Rname

    • b.dns.hostway.net
    • a.dns.hostway.net

    Target

    • hostmaster.siteprotect.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 28 Apr 2016 22:57:53 GMT Server: Apache/2.4.18 Link: ; rel=shortlink Content-Type: text/html; charset=UTF-8

    DNS

    host: scaleschool.com
    1. class: IN
    2. ttl: 14400
    3. type: A
    4. ip: 66.39.70.20
    host: scaleschool.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: b.dns.hostway.net
    host: scaleschool.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: a.dns.hostway.net
    host: scaleschool.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: a.dns.hostway.net
    5. rname: hostmaster.siteprotect.com
    6. serial: 2015051213
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 300

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.caleschool.com, www.secaleschool.com, www.ecaleschool.com, www.swcaleschool.com, www.wcaleschool.com, www.sdcaleschool.com, www.dcaleschool.com, www.sxcaleschool.com, www.xcaleschool.com, www.sfcaleschool.com, www.fcaleschool.com, www.sgcaleschool.com, www.gcaleschool.com, www.stcaleschool.com, www.tcaleschool.com, www.saleschool.com, www.scdaleschool.com, www.sdaleschool.com, www.scraleschool.com, www.sraleschool.com, www.sctaleschool.com, www.staleschool.com, www.scvaleschool.com, www.svaleschool.com, www.scfaleschool.com, www.sfaleschool.com, www.scgaleschool.com, www.sgaleschool.com, www.schaleschool.com, www.shaleschool.com, www.scnaleschool.com, www.snaleschool.com, www.scmaleschool.com, www.smaleschool.com, www.scjaleschool.com, www.sjaleschool.com, www.scleschool.com, www.scaoleschool.com, www.scoleschool.com, www.scapleschool.com, www.scpleschool.com, www.sca9leschool.com, www.sc9leschool.com, www.scaleschool.com, www.scleschool.com, www.scaileschool.com, www.scileschool.com, www.scauleschool.com, www.sculeschool.com, www.scaeschool.com, www.scalueschool.com, www.scaueschool.com, www.scal8eschool.com, www.sca8eschool.com, www.scal9eschool.com, www.sca9eschool.com, www.scaljeschool.com, www.scajeschool.com, www.scal0eschool.com, www.sca0eschool.com, www.scalmeschool.com, www.scameschool.com, www.scalpeschool.com, www.scapeschool.com, www.scaloeschool.com, www.scaoeschool.com, www.scalschool.com, www.scalexschool.com, www.scalxschool.com, www.scalesschool.com, www.scalsschool.com, www.scalewschool.com, www.scalwschool.com, www.scalerschool.com, www.scalrschool.com, www.scalefschool.com, www.scalfschool.com, www.scalevschool.com, www.scalvschool.com, www.scalecschool.com, www.scalcschool.com, www.scaleqschool.com, www.scalqschool.com, www.scaleaschool.com, www.scalaschool.com, www.scaleyschool.com, www.scalyschool.com, www.scalechool.com, www.scalesechool.com, www.scaleechool.com, www.scaleswchool.com, www.scalewchool.com, www.scalesdchool.com, www.scaledchool.com, www.scalesxchool.com, www.scalexchool.com, www.scalesfchool.com, www.scalefchool.com, www.scalesgchool.com, www.scalegchool.com, www.scalestchool.com, www.scaletchool.com, www.scaleshool.com, www.scalescdhool.com, www.scalesdhool.com, www.scalescrhool.com, www.scalesrhool.com, www.scalescthool.com, www.scalesthool.com, www.scalescvhool.com, www.scalesvhool.com, www.scalescfhool.com, www.scalesfhool.com, www.scalescghool.com, www.scalesghool.com, www.scaleschhool.com, www.scaleshhool.com, www.scalescnhool.com, www.scalesnhool.com, www.scalescmhool.com, www.scalesmhool.com, www.scalescjhool.com, www.scalesjhool.com, www.scalescool.com, www.scalescheool.com, www.scalesceool.com, www.scaleschdool.com, www.scalescdool.com, www.scaleschcool.com, www.scalesccool.com, www.scaleschuool.com, www.scalescuool.com, www.scaleschjool.com, www.scalescjool.com, www.scaleschool.com, www.scalescool.com, www.scaleschbool.com, www.scalescbool.com, www.scaleschgool.com, www.scalescgool.com, www.scaleschol.com, www.scaleschobol.com, www.scaleschbol.com, www.scaleschohol.com, www.scaleschhol.com, www.scaleschogol.com, www.scaleschgol.com, www.scaleschojol.com, www.scaleschjol.com, www.scaleschomol.com, www.scaleschmol.com, www.scalescho ol.com, www.scalesch ol.com, www.scaleschovol.com, www.scaleschvol.com, www.scaleschol.com, www.scaleschoobl.com, www.scaleschobl.com, www.scaleschoohl.com, www.scaleschohl.com, www.scaleschoogl.com, www.scaleschogl.com, www.scaleschoojl.com, www.scaleschojl.com, www.scaleschooml.com, www.scaleschoml.com, www.scaleschoo l.com, www.scalescho l.com, www.scaleschoovl.com, www.scaleschovl.com,

    Other websites we recently analyzed

    1. So Cal Bengals | Home of the Southern California Bengals
      Scottsdale (United States) - 50.63.100.1
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 32
      Number of meta tags: 4
    2. dandashahbilawal.xyz
      Cheyenne (United States) - 167.88.160.183
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 3
    3. Koren Helbig | Australian freelance journalist in Spain
      I'm an Australian freelance journalist, writer and blogger based in Spain, writing stories about passionate people doing good in the world.
      Provo (United States) - 66.147.244.144
      Server software: nginx/1.10.1
      Technology: CSS, Gravatar, Html, Javascript, jQuery, Lightbox, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 9
      Number of meta tags: 6
    4. Up2Eleven Consulting – "Whats going on in that mind of yours……"
      Scottsdale (United States) - 192.186.242.96
      Server software: Apache/2.4.23
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
      Number of Javascript: 15
      Number of meta tags: 3
    5. Instant Cashflow Membership Program
      Complete Video Based Membership Site
      Lansing (United States) - 72.52.226.70
      Server software: Apache
      Technology: CSS, Html, Iframe
      Number of meta tags: 4
    6. Infinity Shoes
      Canada - 23.227.38.69
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, SVG, Shopify
      Number of Javascript: 5
      Number of meta tags: 4
    7. netzwerkorange - Web Development
      netzwerkorange is Thomas Gensicke, a freelancing web developer from Berlin, Germany.
      Germany - 80.67.17.118
      Server software: Apache/2.4.20
      Technology: CSS, Html, Html5, Iframe
      Number of Javascript: 2
      Number of meta tags: 3
    8. Tutkryto.NET | У нас всегда весело :) | Ещё один сайт на WordPress
      TutKryto - С намы всегда круто...
      Moscow (Russian Federation) - 82.146.32.59
      G Analytics ID: UA-68658187-1
      Server software: Apache/2.2.22 (@RELEASE@)
      Technology: CSS, Flexslider, Font Awesome, Html, Html5, Iframe, Javascript, jQuery, jQuery Cycle, Php, Pingback, Google Analytics, LiveInternet counter, Wordpress, Facebook Like box, Facebook Box
      Number of Javascript: 16
      Number of meta tags: 6
    9. mtpleasantcriminaldefenselawyer.com
      Scottsdale (United States) - 50.63.202.57
      Server software: squid/3.5.19
      Technology: Html, Html5, Iframe
    10. All Are Called...
      Jacksonville (United States) - 206.188.192.202
      Server software: Apache
      Technology: CSS, Html
      Number of Javascript: 3
      Number of meta tags: 2

    Check Other Websites